TFF1, Human

CAT:
804-HY-P71928-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TFF1, Human - image 1

TFF1, Human

  • Description :

    TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human is the recombinant human-derived TFF1 protein, expressed by E. coli , with tag free.
  • Product Name Alternative :

    TFF1 Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/tff1-protein-human.html
  • Purity :

    97.00
  • Smiles :

    EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
  • Molecular Formula :

    7031 (Gene_ID) P04155 (E25-F84) (Accession)
  • Molecular Weight :

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide