TFF3, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


TFF3, Human
Description :
TFF-3 Protein, Human is a regulatory peptide involved in mucosal protection and repair in the gastrointestinal tract.Product Name Alternative :
TFF3 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsApplications :
Neuroscience-NeuromodulationAssay Protocol :
https://www.medchemexpress.com/cytokines/tff-3-protein-human.htmlPurity :
97.52Smiles :
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTFMolecular Formula :
7033 (Gene_ID) Q07654 (E22-F80) (Accession)Molecular Weight :
Approximately 6.6 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Zhang BH, et al. The therapeutic effect of recombinant human trefoil factor 3 on hypoxia-induced necrotizing enterocolitis in immature rat. Regul Pept. 2003 Nov 15;116 (1-3) :53-60.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

