TFF1 Human

CAT:
1071-OM297410-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TFF1 Human - image 1

TFF1 Human

  • Description :

    TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa.
  • Swiss Prot :

    P04155
  • Source :

    Escherichia Coli.
  • Buffer :

    The Human TFF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.
  • Storage Conditions :

    Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.
  • Sequence Similarities :

    EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide