TFF1 Human

• Description:

  TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa.

• Swiss Prot:

  P04155

• Source:

  Escherichia Coli.

• Buffer:

  The Human TFF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.

• Storage Conditions:

  Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY