Products for Research Use Only
RegisterLogin

Recombinant Human CD83 antigen (CD83)

CAT: 0013-GTR19078526-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19078526-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Human CD83 antigen (CD83) spans the amino acid sequence from region 20-205.
Product Name Alternative
CD83 antigen, hCD83, B-cell activation protein, Cell surface protein HB15, CD_antigen= CD83
UniProt
Q01151
Expression Region
20-205
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV

Related Products

CatalogName
GTR19078580-01Recombinant Mouse CD83 antigen (Cd83)
GTR18842285Human CD83/CD83 antigen ELISA Kit
GTR18864002-01Human CD83 (CD83 antigen) Quick ELISA Kit
GTR19125500-01Recombinant Human CD83 Protein
GTR19124556-01Recombinant Human CD83 Protein
GTR18909984CD83 Recombinant Protein
GTR18907428CD83 Recombinant Protein
GTR18907372CD83 Recombinant Protein
GTR18908923CD83 Recombinant Protein
GTR18910524CD83 Recombinant Protein

Alternative Products

CatalogName
477547CD83 (CD83 Antigen)
MBS954536Recombinant Human CD83 antigen (CD83)
abx377036-01CD83 Antigen (CD83) Antibody
JOT-EK6502Hu-01Human CD83 antigen,CD83 ELISA KIT
BPE223-01Human Cd83 Antigen, CD83 ELISA Kit
RK10682Human CD83 antigen (CD83) ELISA Kit
E2888HuHuman CD83/CD83 antigen ELISA Kit
R9400hHuman CD83 / CD83 antigen Recombinant Protein
BLT-07151P-01Human CD83 (Cd83 Antigen) - Recombinant Protein
MBS7608158-01Human CD83 (CD83 antigen) ELISA Kit

Popular Products