Products for Research Use Only

RecombinantIFN-γ, Human (CHO-expressed)

CAT: 0013-GTR18990319-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990319-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Human Interferon gamma (hIFN-γ) is amacrophage-activating factor and the lone member of Interferon type II. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and sets off IFN-γ/JAK/STAT pathway. IFN-γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity. While IFN-γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers.
Product Name Alternative
Immune Interferon, type II interferon, T cell interferon, MAF, IFNG, IFG, IFI, IFN-gamma, IFNγ
Source
CHO
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 5x10ˆ5 units/mg.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
15-25 kDa, observed by non-reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Interferon gamma (IFN-γ) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rh IFN-γ should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVK FFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ