Products for Research Use Only

RecombinantTGF-α, Human

CAT: 0013-GTR18990254-02Size: 25 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990254-02Size:25 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Protransforming Growth Factor-alpha (TGF-alpha), also known as sarcoma growth factor, TGF-type I and ETGF, is a member of the EGF family of cytokines. It is expressed in monocytes, brain cells, keratinocytes and various tumor cells. ProTGF-alpha signals through EGFR and acts synergistically with TGF-beta to promote the proliferation of a wide range of epidermal and epithelial cells. It may function as either a membrane-bound ligand or a soluble ligand. Membrane-bound proTGF-alpha plays a role in cell-cell adhesion and juxtacrine stimulation of adjacent cells. The soluble form of the cytokine is released from the membrane-bound form by proteolytic cleavage and acts as a mitogen for cell proliferation.
Product Name Alternative
Transforming Growth Factor-α, Sacroma growth factor, TGF-type I, ETGF
Source
CHO
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 0.4 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
8-10 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human TGF-alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TGF-alpha Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA