Products for Research Use Only
RegisterLogin

RecombinantTSG, His, Human

CAT: 0013-GTR18990208-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990208-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Twisted gastrulation (TWSG1 or TSG) is a cysteine-rich 24 kDa glycoprotein. It is a secreted BMP binding protein that modulates BMP ligand availability in extracellular space. Human TSG shares 98% aa identity with mouse and rat TSG, and 99.5% aa identity with canine, equine, bovine and porcine TSG. Glycosylation and bioactivity of TWSG1 recombinant proteins vary markedly by cellular source. Non-glycosylated hTWSG1 made in E. coli has both reduced affinity for BMPs, as shown by surface plasmon resonance analysis, and reduced BMP inhibitory activity in a mandibular explant culture system compared to glycosylated proteins made in insect cells or mouse myeloma cells.Recombinant human Twisted Gastrulation (TSG), produced in HEK 293 cells is a polypeptide chain containing 211 amino acids. A fully biologically active molecule, rhTSG has a molecular mass of 30~33 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Name Alternative
Twisted Gastrulation Protein
Source
HEK 293
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is < 2 μg/ml of TSG.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
30-33 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Twisted Gastrulation (TSG), remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Twisted Gastrulation should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
HHHHHHHHCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDT PPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHH QNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIG PECIDYGSKTVKCMNCMF

Related Products

CatalogName
GTR18990454-01RecombinantTNF-α, His, Human
GTR18990251-01RecombinantTPO, His, Rat
GTR18990254-01RecombinantTGF-α, Human
GTR18990453-01RecombinantTNF-α, Human
GTR18990472-01RecombinantOSM (209aa), Human
GTR18990471-01RecombinantOSM (227aa), Human
GTR18992101-01RecombinantG-CSF, Human
GTR18990194-01RecombinantTNF-α, Human (P.pastoris-expressed)
GTR18894550-01Human DnaK, His
GTR18992057-01Recombinant3Cprotease, His, Human

Alternative Products

CatalogName
BK0334RecombinantTSG,His,Human
BK0334-01RecombinantTSG, His, Human
PT_41578-01Myoglobin His Human Recombinant (Myoglobin His Human)
PT_P10118-01Prolactin Human Recombinant, His Tag (Prolactin Human, His)
PT_75053-01Adiponectin Human Recombinant, His tag (Acrp30 Human, His)
PT_74345-01DnaK Human Recombinant, His Tag (DnaK Human, His)
PT_72828-01Osteoprotegerin Human Recombinant, His Tag (OPG Human, His)
PT_74473-01Cystatin A Human Recombinant, His tag (CSTA Human, His)
PT_74013-01AITRL Human Recombinant, His Tag (AITRL Human, His)
PT_73994-01Glucagon Human Recombinant, His Tag (Glucagon Human, His)

Popular Products