Products for Research Use Only
RegisterLogin

RecombinantVEGF-C, Human

CAT: 0013-GTR18990206-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990206-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D) .Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Name Alternative
Flt4 ligand, VRP
Source
HEK 293
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is < 0.5 μg/mL.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
16~19 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Vascular Endothelial Growth Factor C remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor C should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Related Products

CatalogName
GTR18990247-01RecombinantVEGF-D, Human
GTR18991880-01RecombinantEGF, Human
GTR18991891-01RecombinantEGF, Human
GTR18990254-01RecombinantTGF-α, Human
GTR18990322-01RecombinantHGF, Human
GTR18990188-01RecombinantEGFR, His, Human
GTR18990259-01RecombinantPDGF-DD, Human
GTR18991780-01RecombinantFGF-12, Human
GTR18991658-01RecombinantFGF-8e, Human
GTR18991635-01RecombinantFGF-9, Human

Alternative Products

CatalogName
BK0336-01RecombinantVEGF-C, Human
BK0336RecombinantVEGF-C,Human
BK0294RecombinantVEGF-D,Human
BK0294-01RecombinantVEGF-D, Human
PT_40350-01Cystatin-C Human (Cystatin C Human)
PT_40351-01Cystatin-C Human Recombinant (Cystatin C Human)
OPPA01325-20UGCystatin C Human - Human Cystatin C Protein
PT_40054-01C-SRC/ CSK Human Recombinant (C-SRC Human)
PND-4411-VEndokinin C, human
H-2470.1000C-Peptide (human)

Popular Products