Products for Research Use Only
RegisterLogin

RecombinantVEGF-C, Human

CAT: 0384-BK0336-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0336-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D) .Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is < 0.5 µg/mL.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
16~19 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Vascular Endothelial Growth Factor C remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor C should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Related Products

CatalogName
BK0294-01RecombinantVEGF-D, Human
BK0025-01RecombinantEGF, Human
BK0026-01RecombinantEGF, Human
BK0285-01RecombinantTGF-α, Human
BK0220-01RecombinantHGF, Human
BK0327-01RecombinantPDGF-CC, Human
BK0353-01RecombinantEGFR, His, Human
BK0087-01RecombinantIGF-II, Human
BK0199-01RecombinantFGF-16, Human
BK0047-01RecombinantFGF-8e, Human

Alternative Products

CatalogName
BK0336RecombinantVEGF-C,Human
GTR18990206-01RecombinantVEGF-C, Human
BK0294RecombinantVEGF-D,Human
GTR18990247-01RecombinantVEGF-D, Human
PT_40350-01Cystatin-C Human (Cystatin C Human)
PT_40351-01Cystatin-C Human Recombinant (Cystatin C Human)
OPPA01325-20UGCystatin C Human - Human Cystatin C Protein
PT_40054-01C-SRC/ CSK Human Recombinant (C-SRC Human)
PND-4411-VEndokinin C, human
H-2470.1000C-Peptide (human)

Popular Products