Products for Research Use Only

RecombinantDKK-1, Human

CAT: 0013-GTR18991902-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18991902-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which alsoincludes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbatein vitro. DKK1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK1 not only functions as a head inducer during development, but also regulates joint remodeling and bone formation, which indicate sits role in the pathogenesis of rheumatoid arthritis and multiple myeloma.
Product Name Alternative
DKK1
Source
Escherichia coli.
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 6 μg/ml, measured in stimulation of alkaline phosphatase activity using CCl-226 cells. Up to 180% stimulation of alkaline phosphatase activity was observed at 10.0 ug/ml.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
17-22 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant human DKK1 (rhDKK1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhDKK1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEEC GTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIE ETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICK PVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH