Products for Research Use Only
RegisterLogin

Human GNLY Protein

CAT: 0013-GTR18981815-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18981815-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of human GNLY protein
Product Name Alternative
LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.
Source
Escherichia Coli
Field of Research
Immunology & Inflammation
Purity
Greater than 95.0% as determined by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Granulysin in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Recombinant & Natural Proteins
Preservative
The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
AA Sequence
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH

Related Products

CatalogName
GTR19333444-01GNLY siRNA (Human)
GTR18067055GNLY Antibody
GTR17945275-01GNLY Antibody
GTR18241132-01GNLY Antibody
GTR18141383GNLY Antibody
GTR18148883GNLY Antibody
GTR18820762Human GNLY ELISA Kit
GTR18817490-01Human GNLY ELISA Kit
GTR18801182-01Human GNLY ELISA Kit
GTR18824470-01Human GNLY ELISA Kit

Alternative Products

CatalogName
abx653629-01Human Granulysin (GNLY) Protein
MBS8412413-01Human GNLY Protein Lysate
RP013579GNLY Recombinant Protein (Human)
P515550GNLY Protein (N-Trx, Human)
IHUGNLYPLLY20UGHuman GNLY Protein Lysate 20ug
R1517hHuman GNLY / Granulysin Recombinant Protein
PH39876M5GNLY (NM_006433) Human Recombinant Protein
PROTP22749-01GNLY Granulysin Human Recombinant Protein
E51P90205GNLY protein, Human, Recombinant (His)
MBS2580264-01Recombinant Human GNLY Protein (Trx Tag)

Popular Products