Products for Research Use Only

Human SLC7A5 protein

CAT: 0013-GTR18886161-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18886161-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Human SLC7A5 protein spans the amino acid sequence from region 16-50aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Name Alternative
4F2 light chain Short name: 4F2 LC Short name: 4F2LC CD98 light chain Integral membrane protein E16 Short name: E16 L-type amino acid transporter 1 Short name: hLAT1 Solute carrier family 7 member 5 y+ system cationic amino acid transporter
UniProt
Q01650
Expression Region
16-50aa
Tag
N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI