Human TNR1A protein (Active)

CAT: 0013-GTR18881637-01Size: 5 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18881637-01Size:5 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Human TNR1A protein (Active) spans the amino acid sequence from region 22-211aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Name Alternative

Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-RI, TNFR-I, p55

UniProt

P19438

Expression Region

22-211aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 cells is less than 0.05 μg/ml, corresponding to a specific activity of > 2.0 x 10 ^ 4 IU/mg in the presence of 0.25 ng/mL of rHuTNF-alpha.

Form

Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

UniProtKB · P19438

Tumor necrosis factor receptor superfamily member 1A

TNR1A_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P19438
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: TNFRSF1A
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: A8K4X3, B2RDE4, B3KPQ1, B4DQB7, B4E309, B5M0B5, D3DUR1, Q9UCA4

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Disease

AmyloidosisDisease variant

Biological process

ApoptosisHost-virus interaction

Cellular component

Cell membraneGolgi apparatusMembraneSecreted

PTM

Cleavage on pair of basic residuesDisulfide bondGlycoprotein

Molecular function

Receptor

Domain

RepeatSignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR18881638-01	Human TNR1B protein (Active)
GTR18881629-01	Human TNR17 protein (Active)
GTR18881620-01	Human TNR12 protein (Active)
GTR18881633-01	Human TNR11 protein (Active)
GTR18985459-01	Human Activin-A Active Protein
GTR18985452-01	Human Activin B Active Protein
GTR18985458-01	Human Activin-A Plant-Active Protein
GTR18988639-01	Human Active Protein
GTR19143947-01	Recombinant human Activin A protein (Active, CHO)
GTR18882246-01	Human CCL27 protein (Active)

Alternative Products

Catalog	Name
GWB-A1590A	Akt2 active, Active Human Recombinant Protein
RPU60405-01	Human Neprilysin, Active Protein
RPU60438-01	Human Catalase, Active Protein
RPU60240-01	Human Kallistatin, Active Protein
AR03019PU-N	HSP60 (active) Human Protein
abx655607-01	Human Endostatin Protein (Active)
RPU60713-01	Human Tryptase, Active Protein
RPU60608-01	Human Cubilin, Active Protein
RPU60216-01	Human Granulysin, Active Protein
MBS355522-01	Human albumin Protein (Active)