Human TNR12 protein (Active)

CAT: 0013-GTR18881620-01Size: 5 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18881620-01Size:5 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Human TNR12 protein (Active) spans the amino acid sequence from region 28-80aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Name Alternative

Fibroblast growth factor-inducible immediate-early response protein 14, Tweak-receptor, TweakR, CD antigen CD266

UniProt

Q9NP84

Expression Region

28-80aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inhibiting TWEAK- dependent proliferation of human umbilical vein endothelial cells (HUVEC) is less than 30 ng/ml, corresponding to a specific activity of > 3.3 x 10 ^ 4 IU/mg, in the presence of 15 ng/ml of rHuTWEAK.

Form

Lyophilized powder

Molecular Weight

5.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP

UniProtKB · Q9NP84

Tumor necrosis factor receptor superfamily member 12A

TNR12_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: Q9NP84
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: TNFRSF12A
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: D3DUA6, Q9HCS0

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Biological process

AngiogenesisApoptosisCell adhesionDifferentiation

Molecular function

Developmental proteinReceptor

PTM

Disulfide bond

Cellular component

Membrane

Domain

SignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR18881638-01	Human TNR1B protein (Active)
GTR18881629-01	Human TNR17 protein (Active)
GTR18881633-01	Human TNR11 protein (Active)
GTR18881637-01	Human TNR1A protein (Active)
GTR18985459-01	Human Activin-A Active Protein
GTR18985452-01	Human Activin B Active Protein
GTR18985458-01	Human Activin-A Plant-Active Protein
GTR18988639-01	Human Active Protein
GTR19143947-01	Recombinant human Activin A protein (Active, CHO)
GTR18882246-01	Human CCL27 protein (Active)

Alternative Products

Catalog	Name
GWB-A1590A	Akt2 active, Active Human Recombinant Protein
RPU60405-01	Human Neprilysin, Active Protein
RPU60438-01	Human Catalase, Active Protein
RPU60240-01	Human Kallistatin, Active Protein
AR03019PU-N	HSP60 (active) Human Protein
abx655607-01	Human Endostatin Protein (Active)
RPU60713-01	Human Tryptase, Active Protein
RPU60608-01	Human Cubilin, Active Protein
RPU60216-01	Human Granulysin, Active Protein
MBS355522-01	Human albumin Protein (Active)