Bacterial pbpE protein

CAT: 0013-GTR18882040-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18882040-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Bacterial pbpE protein spans the amino acid sequence from region 1-451aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Name Alternative

PBP 4* Alternative name (s), PBP 4A Penicillin-binding protein E

UniProt

P32959

Expression Region

1-451aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK

UniProtKB · P32959

Penicillin-binding protein 4*

PBPE_BACSU · Bacillus subtilis (strain 168)

View on UniProt ↗

Primary accession: P32959
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: pbpE
Protein existence: 1: Evidence at protein level
Organism: Bacillus subtilis (strain 168)
Taxonomy ID: 224308
Alternative names: PBP 4*
EC number: —
Processing: —
Secondary accessions: —

Protein keywords

Biological process

Cell shapeCell wall biogenesis/degradationPeptidoglycan synthesisSporulation

Technical term

Direct protein sequencingReference proteome

Molecular function

Hydrolase

Cellular component

Membrane

Related Products

Catalog	Name
GTR18882269-01	Bacterial pbpD protein
GTR18882017-01	Bacterial pbpC protein
GTR18882296-01	Bacterial pbpA protein
GTR17909697-01	PbpE Antibody
GTR19249683-01	PBPE hydrochloride
GTR17909700-01	PbpE Antibody (Biotin)
GTR17909699-01	PbpE Antibody (FITC)
GTR17909698-01	PbpE Antibody (HRP)
GTR18883299-01	Bacterial CLPP2 protein
GTR18883264-01	Bacterial NADB protein

Alternative Products

Catalog	Name
OPCA04424-20UG	PBPE Recombinant Protein (Bacillus subtilis)
abx300122-01	Penicillin-Binding Protein E (pbpE) Antibody
HY-NP016-01	Brucella bacterial protein
GWB-PS6392	Bacterial Protein Extraction Buffer
HY-NP022	Mycobacterium bovis bacterial protein
BC3750-01	Bacterial Protein Extraction Kit
TRP-00173-01	E.coli Bacterial protein
MBS400001-01	Bacterial outer membrane protein A
AP74603-01	Recombinant Bacillus subtilis Penicillin-binding protein 4(pbpE)
MBS1098269-01	Recombinant Bacillus subtilis Penicillin-binding protein 4* (pbpE)