Products for Research Use Only
RegisterLogin

Mouse IL4 protein (Active)

CAT: 0013-GTR18881879-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881879-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Mouse IL4 protein (Active) spans the amino acid sequence from region 21-140aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Name Alternative
B cell growth factor 1 protein, B cell IgG differentiation factor protein, B Cell Stimulatory Factor 1 protein, B-cell stimulatory factor 1 protein, BCGF 1 protein, BCGF1 protein, Binetrakin protein, BSF 1 protein, BSF-1 protein, BSF1 protein, IGG1 induction factor protein, IL 4 protein, IL-4 protein, IL4 protein, Interleukin 4 protein, Interleukin 4 variant 2 protein, Interleukin 4, isoform 1 protein, Interleukin-4 protein, Interleukin4 protein, Lymphocyte stimulatory factor 1 protein, Macrophage fusion factor protein, Mast cell growth factor 2 protein, Pitrakinra protein
UniProt
P07750
Expression Region
21-140aa
Tag
Tag-Free
Source
E.Coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant prolifiration of Murine HT-2 cells is less then 2 ng/ml, corresponding to a Specific Activity of > 5.0 x 10 ^ 5 IU/mg.
Form
Lyophilized powder
Molecular Weight
13.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered , PBS, pH 7.4
AA Sequence
M+HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Related Products

CatalogName
GTR18881529-01Monkey IL4 protein (Active)
GTR18881508-01Human IL4 protein (Active)
GTR19025388-01Recombinant Mouse Interleukin-4 protein (Il4) (Active)
GTR19025389-01Recombinant Human Interleukin-4 protein (IL4) (Active)
GTR18905894-01Mouse IL4 protein
GTR18885484-01Mouse IL4 protein
GTR18906102-01Mouse IL4 protein
GTR18885482-01Mouse IL4 protein
GTR19065040-01Recombinant Human Interleukin-4 (IL4) (Active)
GTR19025391-01Recombinant Rhesus Macaque Interleukin-4 protein (IL4) (Active)

Alternative Products

CatalogName
B2022317Lyn Protein, Active Mouse
RPU60623-01Mouse Elastin, Active Protein
RPU60217-01Mouse Adrenomedullin, Active Protein
RPU60688-01Mouse Acetylcholinesterase, Active Protein
RPU60681-01Mouse Thrombopoietin, Active Protein
RPU60604-01Mouse Afamin, Active Protein
RPU60567-01Mouse Cystatin A, Active Protein
RPU60541-01Mouse Leptin, Active Protein
RPU60094-01Mouse Osteopontin, Active Protein
RPU60692-01Mouse Angiogenin, Active Protein

Popular Products