Products for Research Use Only
RegisterLogin

Monkey IL4 protein (Active)

CAT: 0013-GTR18881529-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881529-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Monkey IL4 protein (Active) spans the amino acid sequence from region 25-153aa. Purity: > 96% as determined by SDS-PAGE and HPLC.
Product Name Alternative
B cell growth factor 1 protein, B cell IgG differentiation factor protein, B Cell Stimulatory Factor 1 protein, B-cell stimulatory factor 1 protein, BCGF 1 protein, BCGF1 protein, Binetrakin protein, BSF 1 protein, BSF-1 protein, BSF1 protein, IGG1 induction factor protein, IL 4 protein, IL-4 protein, IL4 protein, Interleukin 4 protein, Interleukin 4 variant 2 protein, Interleukin 4, isoform 1 protein, Interleukin-4 protein, Interleukin4 protein, Lymphocyte stimulatory factor 1 protein, Macrophage fusion factor protein, Mast cell growth factor 2 protein, Pitrakinra protein
UniProt
P51492
Expression Region
25-153aa
Tag
Tag-Free
Source
E.Coli
Origin
Macaca mulatta (Rhesus macaque)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 96% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 6 IU/mg.
Form
Lyophilized powder
Molecular Weight
14.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 2 x PBS, pH 7.4, 5 % trehalose
AA Sequence
HNCHIALREIIETLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLEDFLERLKTIMREKYSKCSS

Related Products

CatalogName
GTR18882389-01Monkey IL4 protein
GTR18881879-01Mouse IL4 protein (Active)
GTR18881508-01Human IL4 protein (Active)
GTR18882268-01Monkey CXL10 protein (Active)
GTR18881735-01Monkey Q9GL44 protein (Active)
GTR18881724-01Monkey F7H1Q6 protein (Active)
GTR18881542-01Monkey IL13 protein (Active)
GTR18881539-01Monkey IL6 protein (Active)
GTR18882279-01Monkey CCL11 protein (Active)
GTR18881583-01Monkey IL8 protein (Active)

Alternative Products

CatalogName
AWH72402Recombinant Cynomolgus monkey TIGIT Protein, C-Fc (Active)
AWC83404Recombinant Cynomolgus monkey CD28 Protein, N-His (Active)
AWH28801Recombinant Cynomolgus monkey IL17A Protein, C-His (Active)
AWK13702Recombinant Cynomolgus monkey SIGLEC15 Protein, C-Fc (Active)
AWC83402Recombinant Cynomolgus monkey CD28 Protein, C-mFc (Active)
AWJ36102Recombinant Cynomolgus monkey TSLP Protein, C-His (Active)
AWH72401Recombinant Cynomolgus monkey TIGIT Protein, C-His (Active)
AWK13701Recombinant Cynomolgus monkey SIGLEC15 Protein, C-His (Active)
AWC83403Recombinant Cynomolgus monkey CD28 Protein, C-Fc (Active)
AWB74001Recombinant Rhesus monkey IL33 Protein, N-His (Active)

Popular Products