Products for Research Use Only
RegisterLogin

Mouse Cryopyrin protein

CAT: 0013-GTR18881182-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881182-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Mouse Cryopyrin protein spans the amino acid sequence from region 1-153aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Name Alternative
AGTAVPRL protein, C1orf7 protein, Caterpiller protein 1.1 protein, CIAS 1 protein, CIAS1 protein, FCAS protein, FCU protein, MWS protein, NACHT protein, NALP 3 protein, NALP3 protein, NLRP3 protein, PYPAF 1 protein, PYPAF1 protein, PYRIN containing APAF1 like protein 1 protein
UniProt
Q8R4B8
Expression Region
1-153aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Epigenetics, Immunology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

Related Products

CatalogName
GTR18884318-01Human Cryopyrin protein
GTR18817408-01Mouse Cryopyrin ELISA Kit
GTR18914854Cryopyrin Peptide
GTR18914853Cryopyrin Peptide
GTR18077615Cryopyrin antibody
GTR18805461-01Mouse Cryopyrin ELISA Kit
GTR18895749Cryopyrin peptide
GTR18194928Cryopyrin Polyclonal Antibody
GTR18065862-01Cryopyrin Polyclonal Antibody
GTR18817105-01Human Cryopyrin ELISA Kit

Alternative Products

CatalogName
350580CIAS1 (NLRP3, PYPAF1, Cryopyrin, NALP3, NACHT, LRR and PYD domains-containing protein 3)
MBS6002814-01NLRP3/NALP3 (NACHT-, LRR- and PYD-containing Protein 3, NLRP3, Cryopyrin, Cold Autoinflammatory Syndrome 1 Protein)
045088-BiotinNLRP3/NALP3 (NACHT-, LRR- and PYD-containing Protein 3, NLRP3, Cryopyrin, Cold Autoinflammatory Syndrome 1 Protein) (Biotin)
N0018-64BNALP3 (NACHT-, LRR- and PYD-Containing Protein 3, Cryopyrin, Cold Autoinflammatory Syndrome 1 Protein, PYPAF1, PYRIN-Containing APAF1-like Protein 1, CIAS1)
N0018-64NALP3 (NACHT-, LRR- and PYD-Containing Protein 3, Cryopyrin, Cold Autoinflammatory Syndrome 1 Protein, PYPAF1, PYRIN-Containing APAF1-like Protein 1, CIAS1) discontinued
298434NALP3, Recombinant, Human, His-Tag (CIAS1, NLRP3, CIAS1, Cryopyrin, PYPAF1, NLR Family Pyrin Domain Containing 3, Cold Autoinflammatory Syndrome 1 Protein)
MBS620913-01NALP3, CT (NACHT-, LRR- and PYD-Containing Protein 3, Cryopyrin, Cold Autoinflammatory Syndrome 1 Protein, PYPAF1, PYRIN-Containing APAF1-like Protein 1, CIAS1, Caterpiller Protein 1.1, CLR1.1, C1orf7, CIAS1, NLRP3, PYPAF1, Angiotensin/Vasopressin Recepto
MBS643156-01NALP3, ID (NACHT-, LRR- and PYD-Containing Protein 3, Cryopyrin, Cold Autoinflammatory Syndrome 1 Protein, PYPAF1, PYRIN-Containing APAF1-like Protein 1, CIAS1, Caterpiller Protein 1.1, CLR1.1, C1orf7, CIAS1, NLRP3, PYPAF1, Angiotensin/Vasopressin Recepto
MBS6008938-01NLRP3, NT (NACHT-, LRR- and PYD-Containing Protein 3, Cryopyrin, Cold Autoinflammatory Syndrome 1 Protein, PYPAF1, PYRIN-Containing APAF1-like Protein 1, CIAS1, Caterpiller Protein 1.1, CLR1.1, C1orf7, CIAS1, NLRP3, PYPAF1, Angiotensin/Vasopressin Recepto
MBS6489317-01NALP3, ID (NACHT-, LRR-and PYD-Containing Protein 3, Cryopyrin, Cold Autoinflammatory Syndrome 1 Protein, PYPAF1, PYRIN-Containing APAF1-like Protein 1, CIAS1, Caterpiller Protein 1.1, CLR1.1, C1orf7, CIAS1, NLRP3, PYPAF1, Angiotensin/Vasopressin Receptor

Popular Products