Epigen, Human

• Description:

  Epigen Protein, Human is a EGF-like growth factor that does not stimulate cells singly expressing ErbB-2, but acts as a mitogen for cells expressing ErbB-1 and co-expressing ErbB-2 in combination with the other ErbBs, with potent mitogenic activity.

• Product Name Alternative:

  Epigen Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/epigen-protein-human.html

• Purity:

  95.00

• Smiles:

  AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA

• Molecular Formula:

  255324 (Gene_ID) Q6UW88-2 (A24-A95) (Accession)

• Molecular Weight:

  Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]Kochupurakkal BS, et al. Epigen, the last ligand of ErbB receptors, reveals intricate relationships between affinity and mitogenicity. J Biol Chem. 2005 Mar 4;280 (9) :8503-12.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins