Epigen, Human

• Description :

  Epigen Protein, Human is a EGF-like growth factor that does not stimulate cells singly expressing ErbB-2, but acts as a mitogen for cells expressing ErbB-1 and co-expressing ErbB-2 in combination with the other ErbBs, with potent mitogenic activity.

• Product Name Alternative :

  Epigen Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/epigen-protein-human.html

• Purity :

  95.00

• Smiles :

  AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA

• Molecular Formula :

  255324 (Gene_ID) Q6UW88-2 (A24-A95) (Accession)

• Molecular Weight :

  Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Kochupurakkal BS, et al. Epigen, the last ligand of ErbB receptors, reveals intricate relationships between affinity and mitogenicity. J Biol Chem. 2005 Mar 4;280 (9) :8503-12.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins