EXTL2, Mouse (HEK293, His)

• Description:

  The EXTL2 protein is a key glycosyltransferase in heparan sulfate biosynthesis, responsible for overseeing the conversion of β-1-4-linked glucuronic acid (GlcA) and α-1-4-linked N-acetylglucosamine (GlcNAc) units Alternating sulfate chains are added to the nascent heparan. The function of this enzyme is critical for the complex and precise construction of heparan sulfate, a key component of various biological processes. EXTL2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EXTL2 protein, expressed by HEK293 , with N-6*His labeled tag.

• Product Name Alternative:

  EXTL2 Protein, Mouse (HEK293, His), Mouse, HEK293

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/extl2-protein-mouse-hek-293-his.html

• Smiles:

  NIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM

• Molecular Formula:

  58193 (Gene_ID) Q9ES89 (N43-M330) (Accession)

• Molecular Weight:

  Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Scientific Category:

  Recombinant Proteins