EXTL2, Mouse (HEK293, His)

CAT:
804-HY-P70908
Size:
1 Each
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
EXTL2, Mouse (HEK293, His) - image 1

EXTL2, Mouse (HEK293, His)

  • Description:

    The EXTL2 protein is a key glycosyltransferase in heparan sulfate biosynthesis, responsible for overseeing the conversion of β-1-4-linked glucuronic acid (GlcA) and α-1-4-linked N-acetylglucosamine (GlcNAc) units Alternating sulfate chains are added to the nascent heparan. The function of this enzyme is critical for the complex and precise construction of heparan sulfate, a key component of various biological processes. EXTL2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EXTL2 protein, expressed by HEK293 , with N-6*His labeled tag.
  • Product Name Alternative:

    EXTL2 Protein, Mouse (HEK293, His), Mouse, HEK293
  • UNSPSC:

    12352202
  • Type:

    Recombinant Proteins
  • Assay Protocol:

    https://www.medchemexpress.com/cytokines/extl2-protein-mouse-hek-293-his.html
  • Smiles:

    NIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM
  • Molecular Formula:

    58193 (Gene_ID) Q9ES89 (N43-M330) (Accession)
  • Molecular Weight:

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions:

    Room temperature in continental US; may vary elsewhere.
  • Scientific Category:

    Recombinant Proteins