CD47, Mouse (HEK293)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CD47, Mouse (HEK293)
Description :
The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP) . CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.Product Name Alternative :
CD47 Protein, Mouse (HEK293), Mouse, HEK293UNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/cd47-protein-mouse-hek293-tag-free.htmlPurity :
98.0Smiles :
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKMolecular Formula :
16423 (Gene_ID) Q61735-1/ADQ12919.1 (Q19-K140) (Accession)Molecular Weight :
Approximately 25-40 kDaReferences & Citations :
[1]Sick E, et al. Activation of CD47 receptors causes proliferation of human astrocytoma but not normal astrocytes via an Akt-dependent pathway. Glia. 2011 Feb;59 (2) :308-19.|[2]Ghantous L, et al. The DNA damage response pathway regulates the expression of the immune checkpoint CD47. Commun Biol. 2023 Mar 7;6 (1) :245.|[3]Sick E, et al. CD47 update: a multifaceted actor in the tumour microenvironment of potential therapeutic interest. Br J Pharmacol. 2012 Dec;167 (7) :1415-30.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

