CD47, Mouse (HEK293)

• Description :

  The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP) . CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.

• Product Name Alternative :

  CD47 Protein, Mouse (HEK293), Mouse, HEK293

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/cd47-protein-mouse-hek293-tag-free.html

• Purity :

  98.0

• Smiles :

  QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

• Molecular Formula :

  16423 (Gene_ID) Q61735-1/ADQ12919.1 (Q19-K140) (Accession)

• Molecular Weight :

  Approximately 25-40 kDa

• References & Citations :

  [1]Sick E, et al. Activation of CD47 receptors causes proliferation of human astrocytoma but not normal astrocytes via an Akt-dependent pathway. Glia. 2011 Feb;59 (2) :308-19.|[2]Ghantous L, et al. The DNA damage response pathway regulates the expression of the immune checkpoint CD47. Commun Biol. 2023 Mar 7;6 (1) :245.|[3]Sick E, et al. CD47 update: a multifaceted actor in the tumour microenvironment of potential therapeutic interest. Br J Pharmacol. 2012 Dec;167 (7) :1415-30.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins