Products for Research Use Only
RegisterLogin

CD47, Mouse (HEK293)

CAT: 0804-HY-P74289A-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P74289A-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP) . CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.
Product Name Alternative
CD47 Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd47-protein-mouse-hek293-tag-free.html
Purity
98.0
Smiles
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
Molecular Formula
16423 (Gene_ID) Q61735-1/ADQ12919.1 (Q19-K140) (Accession)
Molecular Weight
Approximately 25-40 kDa
References & Citations
[1]Sick E, et al. Activation of CD47 receptors causes proliferation of human astrocytoma but not normal astrocytes via an Akt-dependent pathway. Glia. 2011 Feb;59 (2) :308-19.|[2]Ghantous L, et al. The DNA damage response pathway regulates the expression of the immune checkpoint CD47. Commun Biol. 2023 Mar 7;6 (1) :245.|[3]Sick E, et al. CD47 update: a multifaceted actor in the tumour microenvironment of potential therapeutic interest. Br J Pharmacol. 2012 Dec;167 (7) :1415-30.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P72917-01CD47, Human (HEK293)
HY-P70820-01CD47, Mouse (140a.a, HEK293, His)
HY-P78639CD47, Canine (HEK293, His)
HY-P704478CD47 , Human (HEK293, Fc)
HY-P704477CD47 , Human (HEK293, mFc)
HY-P7336-01CD47, Human (HEK293, His)
HY-P78611CD47, Rabbit (HEK293, Fc)
HY-P7335-01CD47, Human (HEK293, Fc)
HY-P75402-01CD47, Rat (HEK293, Fc)
HY-P75401-01CD47, Rat (HEK293, His)

Alternative Products

CatalogName
MBS8117175-01Mouse CD47 HEK293 Overexpression Lysate
71249CD47 - HEK293 Cell Line
MBS8117540-01Rat CD47 HEK293 Overexpression Lysate
MBS8114944-01Human CD47 HEK293 Overexpression Lysate
MBS8118032-01Cynomolgus CD47 HEK293 Overexpression Lysate
E24C00048Human CD47 (Knockout) HEK293 Cell Line
ABC-RC0085Human CD47 Reporter Cell Line-HEK293
bs-47066P-01Recombinant human CD47 Protein, C-His (HEK293)
bs-47067P-01Recombinant human CD47 Protein, C-hFc (HEK293)
YP-W21554-01Mouse CD47 (CD47) ELISA Kit

Popular Products