Products for Research Use Only

Complement C3a, Mouse

CAT: 0804-HY-P7863-06Size: 250 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7863-06Size:250 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Complement C3/C3a protein activates the complement system, playing a central role in both classical and alternative pathways. C3b binds covalently to cell surface carbohydrates or immune aggregates, while C3a acts as an inflammatory mediator, inducing neutrophil chemoattraction and promoting smooth muscle contraction, increased vascular permeability, and histamine release. The shorter isoform of C3a stimulates B-cells. Complement C3a Protein, Mouse is the recombinant mouse-derived Complement C3/C3a protein, expressed by E. coli , with tag free.
Product Name Alternative
Complement C3a Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/complement-c3-c3a-protein-mouse.html
Purity
96.00
Smiles
SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR
Molecular Formula
12266 (Gene_ID) P01027-1 (S671-R748) (Accession)
Molecular Weight
Approximately 10 kDa
References & Citations
[1]Shi S, et al., The complement C3a/C3aR pathway is associated with treatment resistance to gemcitabine-based neoadjuvant therapy in pancreatic cancer. Comput Struct Biotechnol J. 2024 Oct 5;23:3634-3650.|[2]Li S, et al., Microglia mediate memory dysfunction via excitatory synaptic elimination in a fracture surgery mouse model. J Neuroinflammation. 2024 Sep 16;21 (1) :227.|[3]Zhang L, et al., C-reactive protein inhibits C3a/C3aR-dependent podocyte autophagy in favor of diabetic kidney disease. FASEB J. 2022 Jun;36 (6) :e22332.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins