Complement C3a, Mouse

CAT:
804-HY-P7863-03
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Complement C3a, Mouse - image 1

Complement C3a, Mouse

  • Description :

    Complement C3/C3a protein activates the complement system, playing a central role in both classical and alternative pathways. C3b binds covalently to cell surface carbohydrates or immune aggregates, while C3a acts as an inflammatory mediator, inducing neutrophil chemoattraction and promoting smooth muscle contraction, increased vascular permeability, and histamine release. The shorter isoform of C3a stimulates B-cells. Complement C3a Protein, Mouse is the recombinant mouse-derived Complement C3/C3a protein, expressed by E. coli , with tag free.
  • Product Name Alternative :

    Complement C3a Protein, Mouse, Mouse, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/complement-c3-c3a-protein-mouse.html
  • Purity :

    96.00
  • Smiles :

    SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR
  • Molecular Formula :

    12266 (Gene_ID) P01027-1 (S671-R748) (Accession)
  • Molecular Weight :

    Approximately 10 kDa
  • References & Citations :

    [1]Shi S, et al., The complement C3a/C3aR pathway is associated with treatment resistance to gemcitabine-based neoadjuvant therapy in pancreatic cancer. Comput Struct Biotechnol J. 2024 Oct 5;23:3634-3650.|[2]Li S, et al., Microglia mediate memory dysfunction via excitatory synaptic elimination in a fracture surgery mouse model. J Neuroinflammation. 2024 Sep 16;21 (1) :227.|[3]Zhang L, et al., C-reactive protein inhibits C3a/C3aR-dependent podocyte autophagy in favor of diabetic kidney disease. FASEB J. 2022 Jun;36 (6) :e22332.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide