VEGF-C Recombinant Protein
CAT:
209-R20-015
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

VEGF-C Recombinant Protein
- Description: VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGF C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A. The recombinant rat VEGF-C contains 127 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 15-20 kDa protein in SDS-PAGE under reducing conditions.
- Synonyms: vascular endothelial growth factor C; Vegfc
- CAS Number: 9000-83-3
- NCBI Gene ID: 114111
- UniProt: O35757
- Accession Number: NP_446105.1
- Accession Number mRNA: NM_053653.1
- Gene Location: 16p11
- Host: Insect Cells
- Origin Species: Rat
- Species Reactivity: Rat
- Sequence: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH
- Detection Range: The biological activity was determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC).
- Purity: > 90% by SDS-PAGE
- Length: 127
- Form: Lyophilized
- Buffer: 50 mM acetic acid
- Reconstitution: The lyophilized VEGF-C is soluble in water and most aqueous buffers. The lyophilized VEGF-C should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.
- Molecular Weight: 15.0 - 20.0 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF-C should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!