VEGF-C152S

• Description:

  VEGF-C152S is a point mutant generated by the replacement of the second conserved Cys residue of the recombinant processed VEGF-C by a Ser residue. VEGF-C152S is analog to the human VEGF-C156S mutant and only active toward VEGFR-3/FLT-4 but, unlike wild type VEGF-C, is unable to bind to and to activate signalling through VEGFR-2/KDR. VEGF-C152S was inactive in the vascular permeability assay and did not increase migration of the capillary endothelial cells, indicating that these VEGF-like effects of VEGF-C require VEGFR-2 binding. VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A. The recombinant rat VEGF-C contains 127 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation recombinant rat VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

• Synonyms:

  Vascular endothelial growth factor C, Vegfc, VRP, Flt4 ligand, Flt4-L

• NCBI Gene ID:

  114111

• UniProt:

  O35757

• Accession Number:

  NP_446105.1

• Accession Number mRNA:

  NM_053653.1

• Chromosomal Location:

  16p11

• Reactivity:

  Rat

• Cross Reactivity:

  Rat

• Label:

  His-Tag

• Sequence:

  DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPSVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH

• Assay Protocol:

  The lyophilized VEGF-C152S is soluble in water and most aqueous buffers. The lyophilized VEGF-C152S should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.

• Purity:

  > 90% by SDS-PAGE

• Bioactivity:

  (A) The proliferative response to rrVEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells (in vitro) . (B) The lymphangiogenic response to rrVEGF-CC152S loaded in a biopolymeric albumin-alginate microcapsules for targeted slow-release was assayed in male Wistar rats.

• Length:

  127

• Form:

  Lyophilized

• Buffer:

  50 mM acetic acid

• Additives:

  BSA (50-fold)

• Reconstitution:

  PBS

• Molecular Weight:

  18.0 - 24.0 kDa

• Storage Conditions:

  Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF-C152S should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!

• Host or Source:

  Insect cells