VEGF-B167 Recombinant Protein
CAT:
209-300-080S
Size:
5 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
VEGF-B167 Recombinant Protein
- Description: VEGF-B, a member of the VEGF family, is a potent growth and angiogenic cytokine. It promotes DNA synthesis in endothelial cells, helps regulate angiogenesis and vascular permeability, and inhibits apoptosis in certain smooth muscle cells and neurons. VEGF-B is expressed in all tissues except the liver. It forms cell surfaced-associated disulfide linked homodimers and can form heterodimers with VEGF-A. There are two known isoforms, formed by alternative splicing, which have been designated VEGF-B167 and VEGF-B186. Both forms have identical amino-terminal sequences encoding a “cysteine knot” like structural motif, but differ in their carboxyl-terminal domains. Both VEGF-B isoforms signal only through the VEGFR1 receptor. Recombinant human VEGF-B is a 38.0 kDa disulfide-linked homodimeric protein consisting of two 167 amino acid polypeptide chains.
- Synonyms: vascular endothelial growth factor B; VEGFB; VRF; VEGFL
- CAS Number: 9000-83-3
- NCBI Gene ID: 7423
- UniProt: P49765
- Accession Number: NP_003368.1
- Accession Number mRNA: NM_003377.4
- Gene Location: 11Q13
- Host: E. coli
- Origin Species: Human
- Species Reactivity: Human
- Sequence: MPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQGRGLELNPDTCRCRKLRR
- Detection Range: Measured by its binding ability in a functional ELISA. Immobilized human sVEGFR-1/Flt-1 at 1 µg/mL (100 µL/well) can bind rhVEGF-B167 with a linear range of 0.5 ng/mL to 12.5 ng/mL.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98% by SDS-PAGE & Coomassie stain
- Length: 167
- Form: Lyophilized
- Buffer: 50mM acetic acid
- Reconstitution: The lyophilized VEGF-B167 should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
- Molecular Weight: 38 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: Lyophilized samples are stable for greater than six months at –20°C to –70°C. Reconstituted VEGF-B167 should be stored in working aliquots at -20°C.