VEGF-C

CAT:
209-300-078
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
VEGF-C - image 1

VEGF-C

  • Description :

    VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The human VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant human VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant human VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A. The recombinant human VEGF-C contains 121 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.
  • Synonyms :

    Vascular endothelial growth factor C; VEGFC; VRP; Flt4-L; VEGF c
  • NCBI Gene ID :

    7424
  • UniProt :

    P49767
  • Accession Number :

    NP_005420.1
  • Accession Number mRNA :

    NM_005429.2
  • Chromosomal Location :

    11q13
  • Reactivity :

    Human
  • Cross Reactivity :

    Human
  • Label :

    His-Tag
  • Sequence :

    DPTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLHHHHHH
  • Assay Protocol :

    The lyophilized VEGF-C is soluble in water and most aqueous buffers. The lyophilized VEGF-C should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.
  • Purity :

    > 90% by SDS-PAGE
  • Bioactivity :

    The biological activity was determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC) .
  • Length :

    121
  • Form :

    Lyophilized
  • Buffer :

    Water
  • Additives :

    BSA (50-fold)
  • Reconstitution :

    Water
  • Molecular Weight :

    18.0-24.0 kDa
  • Storage Conditions :

    Lyophilized samples are stable for more than six months at -20°C to -70°C. Reconstituted VEGF-C should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.
  • Host or Source :

    Insect cells
  • N Terminal Sequence :

    DPTEETI

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide