VEGF164

CAT:
209-R20-067S
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
VEGF164 - image 1

VEGF164

  • Description:

    Rat Vascular Endothelial Growth Factor164 (VEGF164), a 19.23 kDa protein consisting of 164 amino acid residues, is produced as a homodimer. VEGF164 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF164 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1) . Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. All dimeric forms possess similar biological activities. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities. The full ORF of native rat VEGF164 (Ala27-Arg190) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols
  • Synonyms:

    Vascular endothelial growth factor A; Vegfa; Vegf; VEGF164
  • NCBI Gene ID:

    83785
  • UniProt:

    P16612
  • Accession Number:

    NP_114024.2.
  • Accession Number mRNA:

    NM_031836.2
  • Reactivity:

    Rat
  • Cross Reactivity:

    Rat
  • Sequence:

    APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
  • Assay Protocol:

    The lyophilized VEGF164 should be reconstituted in ddH2O to a concentration not lower than 50µg/ml.
  • Purity:

    > 90% by SDS-PAGE
  • Bioactivity:

    Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml.
  • Length:

    164
  • Form:

    Lyophilized (freeze-dried)
  • Buffer:

    PBS
  • Reconstitution:

    Water
  • Molecular Weight:

    19.23 kDa
  • Storage Conditions:

    Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF164 should be stored in working aliquots at -20°C
  • Host or Source:

    E. coli
  • N Terminal Sequence:

    APTTEGEQKAH