VEGF164

• Description:

  Rat Vascular Endothelial Growth Factor164 (VEGF164), a 19.23 kDa protein consisting of 164 amino acid residues, is produced as a homodimer. VEGF164 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF164 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1) . Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. All dimeric forms possess similar biological activities. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities. The full ORF of native rat VEGF164 (Ala27-Arg190) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols

• Synonyms:

  Vascular endothelial growth factor A; Vegfa; Vegf; VEGF164

• NCBI Gene ID:

  83785

• UniProt:

  P16612

• Accession Number:

  NP_114024.2.

• Accession Number mRNA:

  NM_031836.2

• Reactivity:

  Rat

• Cross Reactivity:

  Rat

• Sequence:

  APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

• Assay Protocol:

  The lyophilized VEGF164 should be reconstituted in ddH2O to a concentration not lower than 50µg/ml.

• Purity:

  > 90% by SDS-PAGE

• Bioactivity:

  Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml.

• Length:

  164

• Form:

  Lyophilized (freeze-dried)

• Buffer:

  PBS

• Reconstitution:

  Water

• Molecular Weight:

  19.23 kDa

• Storage Conditions:

  Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF164 should be stored in working aliquots at -20°C

• Host or Source:

  E. coli

• N Terminal Sequence:

  APTTEGEQKAH