PTHrP Recombinant Protein

CAT:

209-100-275

Size:

50 µg

Price:

Ask

For price, please contact [email protected]

Description: PTHrP is a polypeptide hormone produced by almost every tissue of the body. PTHrP is closely related to parathyroid hormone (PTH), which is secreted from the parathyroid gland, and plays a central role in regulating the extracellular concentrations of calcium and phosphorous. Recombinant human PTHrP is a 9.8 kDa linear polypeptide of 86 amino acid residues.
Synonyms: Parathyroid Hormone-related Protein
NCBI Gene ID: 5744
UniProt: P12272
Accession Number: NP_002811.1
Accession Number mRNA: NM_002820.2
Host: E. coli
Origin Species: Human
Species Reactivity: Human
Sequence: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP
Detection Range: Data not available.
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Purity: > 98% by SDS-PAGE & HPLC analyses
Length: 86
Form: Lyophilized
Molecular Weight: 9.8 kDa
Shipping Conditions: Room Temperature

Cat	Name
100-275	PTHrP Recombinant Protein
100-275S	PTHrP Recombinant Protein
500-046	Leptin binding protein Recombinant Protein
100-106	LIGHT Recombinant Protein
R20-047	GDNF Recombinant Protein
M10-093	HGF Recombinant Protein
M10-124	NOGGIN Recombinant Protein
M30-004	VEGF164 Recombinant Protein
R20-062	PlGF Recombinant Protein
R20-064	VEGF120 Recombinant Protein

Cat	Name
40-154-005mg	PTHrP Recombinant Protein
40-154-001mg	PTHrP Recombinant Protein
GWB-B668DA	PTHrP (Recombinant)
CD01027-10ug	Recombinant Human PTHrP protein
PROTP12272	Recombinant Human PTHrP Protein
30R-2372	PTHrP protein
MBS538263-01	PTHrP protein
30R-AP028	PTHrP protein
MBS538263-02	PTHrP protein
MBS8433243-INQUIRE	Human PTHrP Recombinant Protein Lyophilized