Prolactin Recombinant Protein

Prolactin Recombinant Protein

• Description: Recombinant rabbit prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (unpublished data).
• Synonyms: Mammotropin, Luterotropic hormone, Lutetropin
• CAS Number: 9000-83-3
• NCBI Gene ID: 100009394
• UniProt: Q28632
• Accession Number: NP_001076144.1
• Accession Number mRNA: NM_001082675.1
• Host: E. coli
• Origin Species: Rabbit
• Species Reactivity: Rabbit
• Sequence: APICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
• Detection Range: Recombinynt rbPRL is fully biologically active as evidenced by inducing proliferation of Nb2 cells and Baf3 cells stably transfected with rabbit prolactin receptor, algough its relative activity as compared to human prolactin is respectively 8-fold and 4-fold lower. Rabbit PRL forms also 1:1 complex with rabbit PRLR-ECD.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 98% by SDS-PAGE & HPLC analyses
• Length: 199
• Form: Lyophilized
• Reconstitution: It is recommended to reconstitute the lyophilized rbPRL in sterile 0.04% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Molecular Weight: 23.0 kDa
• Shipping Conditions: Room Temperature