Prolactin Recombinant Protein
CAT:
209-500-083S
Size:
10 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Prolactin Recombinant Protein
- Description: Recombinant chickenn prolactin, (chPRL) one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques as described by Oclon et al (2017) GCE 240, 27-34.
- Synonyms: Mammotropin, Luterotropic hormone, Lutetropin
- CAS Number: 9000-83-3
- NCBI Gene ID: 396453
- UniProt: P14676
- Accession Number: NP_990797.2
- Accession Number mRNA: NM_205466.3
- Host: E. coli
- Origin Species: Chicken
- Species Reactivity: Chicken
- Sequence: ALPICPIGSVNCQVSLGELFDRAVKLSHYIHYLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQAQQIHHEDLLNLVVGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVHSGDAGNEIYSHWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDSNC
- Detection Range: Recombinant hPRL is biologically active as evidenced by inducing proliferation of Nb2 cells and baf/3 cells stably transfected with hPRL receptors and by in vivo in chicken.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 95% by SDS-PAGE & HPLC analyses
- Length: 199
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized chPRL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
- Molecular Weight: 23.0 kDa
- Shipping Conditions: Room Temperature