Prolactin Recombinant Protein

Prolactin Recombinant Protein

• Description: Recombinant ovine prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (see Leibovich et al., Protein Expr Purif. 2001 22:489-96).
• Synonyms: Mammotropin, Luterotropic hormone, Lutetropin
• CAS Number: 9000-83-3
• NCBI Gene ID: 443317
• UniProt: P01240
• Accession Number: NP_001009306.1
• Accession Number mRNA: NM_001009306.1
• Host: E. coli
• Origin Species: Ovine
• Species Reactivity: Ovine
• Sequence: ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
• Detection Range: Recombinant oPRL is fully biologically active as evidenced by inducing proliferation of Nb2 cells.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 99% by SDS-PAGE & HPLC analyses
• Length: 199
• Form: Lyophilized
• Reconstitution: It is recommended to reconstitute the lyophilized oPRL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
• Molecular Weight: 23.0 kDa
• Shipping Conditions: Room Temperature