Lyve-1, soluble

CAT:
209-S01-026
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Lyve-1, soluble - image 1

Lyve-1, soluble

  • Description :

    A DNA sequence encoding the extracellular domain of mouse LYVE-1 (Met1 – Gly228) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ala24. sLYVE-1 has a calculated monomeric molecular mass of about 25 kDa but as a result of glycosylation, migrates at approximately 35 - 45 kDa under reducing conditions in SDS-PAGE. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.
  • Synonyms :

    Lyve1; Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik
  • NCBI Gene ID :

    114332
  • UniProt :

    Q8BHC0
  • Accession Number :

    NP_444477
  • Accession Number mRNA :

    NM_053247
  • Chromosomal Location :

    7; 7F2
  • Reactivity :

    Mouse
  • Cross Reactivity :

    Mouse
  • Label :

    His-Tag
  • Sequence :

    ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH
  • Assay Protocol :

    The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.
  • Purity :

    > 95% by SDS-PAGE
  • Bioactivity :

    Not tested so far!
  • Length :

    211
  • Form :

    Lyophilized
  • Buffer :

    PBS
  • Reconstitution :

    Water
  • Molecular Weight :

    ~ 35.0 - 45.0 kDa
  • Storage Conditions :

    Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!
  • Host or Source :

    Insect cells
  • N Terminal Sequence :

    ADLVQDLS

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide