Leptin antagonist (mutant L39A/D40A/F41A) Recombinant Protein
CAT:
209-500-041
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Leptin antagonist (mutant L39A/D40A/F41A) Recombinant Protein
- Description: Recombinant human leptin is one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Recombinant human leptin was mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques. Preparation of leptin antagonists was recently published in Biochemical Journal (Niv-Spector et al, Biochem. J 291;221-230 (2005).
- Synonyms: Lep; ob; obese
- CAS Number: 9000-83-3
- NCBI Gene ID: 3952
- UniProt: P41159
- Accession Number: NP_000221.1
- Accession Number mRNA: NM_000230
- Host: E. coli
- Origin Species: Human
- Species Reactivity: Human
- Sequence: AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGAAAIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
- Detection Range: Recombinant human leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Length: 146
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized recombinant human leptin antagonist in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions preferably in presence of carrier protein.
- Molecular Weight: 16.0 kDa
- Shipping Conditions: Room Temperature