Leptin Recombinant Protein
CAT:
209-500-057S
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Leptin Recombinant Protein
- Description: Recombinant bovine leptin is an one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Bovine leptin was purified by proprietary chromatographic techniques, see Raver et al. Prot. Express. Purif. 19, 30-40 (2000).
- Synonyms: Lep; ob; obese
- CAS Number: 9000-83-3
- NCBI Gene ID: 280836
- UniProt: P50595
- Accession Number: NP_776353.2
- Accession Number mRNA: NM_173928.2
- Host: E. coli
- Origin Species: Bovine
- Species Reactivity: Rat
- Sequence: AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILTSLPSRNVVQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPGC
- Detection Range: Recombinant bovine leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Length: 146
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized recombinant bovine leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
- Molecular Weight: 16.0 kDa
- Shipping Conditions: Room Temperature