Leptin Recombinant Protein

Leptin Recombinant Protein

• Description: Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, Recombinant ovine leptin was purified by proprietary chromatographic techniques, see Gertler et al. FEBS Lett. 442, 137-140 (1998).
• Synonyms: Lep; ob; obese
• CAS Number: 9000-83-3
• NCBI Gene ID: 443534
• Accession Number: XP_027824581.2
• Accession Number mRNA: XM_027968780.2
• Host: E. coli
• Origin Species: Ovine
• Species Reactivity: Ovine
• Sequence: AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
• Detection Range: Recombinant ovine leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 95.0% as determined by Gel filtration and SDS-PAGE gel.
• Length: 146
• Form: Lyophilized
• Reconstitution: It is recommended to reconstitute the lyophilized recombinant ovine leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Molecular Weight: 16.0 kDa
• Shipping Conditions: Room Temperature