IL-4 Recombinant Protein
CAT:
209-200-021
Size:
2 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

IL-4 Recombinant Protein
- Description: IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant human IL-4 is a 14.9 kDa globular protein containing 130 amino acid residues
- Synonyms: IL4; BSF1; IL-4; BCGF1; BSF-1; BCGF-1
- CAS Number: 9000-83-3
- NCBI Gene ID: 3565
- UniProt: P05112
- Accession Number: NP_000580
- Accession Number mRNA: NM_000589
- Gene Location: 5q31.1
- Host: E. coli
- Origin Species: Human
- Species Reactivity: Human
- Sequence: MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
- Detection Range: The ED50 as determined by the dose-dependent stimulation of human TF-1 cells is 0.1-0.5ng/ml.
- Endotoxin: < 0.1 ng per µg of IL-4
- Purity: > 98% by SDS-PAGE
- Length: 130
- Form: Lyophilized
- Buffer: PBS
- Reconstitution: The lyophilized IL-4 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
- Molecular Weight: 14.9 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: The lyophilized IL-4, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.