Login

IL-3 Recombinant Protein

CAT:
209-200-015-SC
Size:
50 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL-3 Recombinant Protein - image 1

IL-3 Recombinant Protein

  • Description: IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. Recombinant human IL-3 is a 15.0 kDa globular protein containing 133 amino acid residues.
  • Synonyms: IL3; IL-3; MCGF; MULTI-CSF
  • CAS Number: 9000-83-3
  • NCBI Gene ID: 3562
  • UniProt: P08700
  • Accession Number: NP_000579
  • Accession Number mRNA: NM_000588
  • Gene Location: 5q31.1
  • Host: E. coli
  • Origin Species: Human
  • Species Reactivity: Human
  • Sequence: MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
  • Detection Range: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 0.1 – 0.5 ng/ml. The WHO standard #91/510 was used as a control.
  • Endotoxin: < 0.1 ng per µg (IEU/µg) of rh IL-3
  • Purity: >98% by SDS-PAGE
  • Length: 134
  • Form: Lyophilized
  • Buffer: PBS
  • Reconstitution: The lyophilized IL-3 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
  • Molecular Weight: 15.0 kDa
  • Shipping Conditions: Room Temperature
  • Storage Conditions: The lyophilized IL-3, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-3 should be stored in working aliquots at -20°C.