IL-3 Recombinant Protein

IL-3 Recombinant Protein

• Description: IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. Recombinant human IL-3 is a 15.0 kDa globular protein containing 133 amino acid residues.
• Synonyms: IL3; IL-3; MCGF; MULTI-CSF
• CAS Number: 9000-83-3
• NCBI Gene ID: 3562
• UniProt: P08700
• Accession Number: NP_000579
• Accession Number mRNA: NM_000588
• Gene Location: 5q31.1
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Human
• Sequence: MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
• Detection Range: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 0.1 – 0.5 ng/ml. The WHO standard #91/510 was used as a control.
• Endotoxin: < 0.1 ng per µg (IEU/µg) of rh IL-3
• Purity: >98% by SDS-PAGE
• Length: 134
• Form: Lyophilized
• Buffer: PBS
• Reconstitution: The lyophilized IL-3 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
• Molecular Weight: 15.0 kDa
• Shipping Conditions: Room Temperature
• Storage Conditions: The lyophilized IL-3, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-3 should be stored in working aliquots at -20°C.