IL-1 beta

CAT:
209-400-002
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL-1 beta - image 1

IL-1 beta

  • Description :

    Interleukin-1 beta (IL-1beta) is produced by activated macrophages. IL-1beta stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1beta proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL1F1) and IL1 beta (IL1F2), which are the products of distinct genes. IL- 1 alpha and IL-1 beta are structurally related polypeptides that share approximately 21% amino acid (aa) identity in human. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. The human IL-1 beta cDNA encodes a 269 aa precursor. A 116 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta converting enzyme (Caspase1/ICE) to generate the active cytokine. The mature human IL-1 beta shares 96% aa sequence identity with rhesus and 67% 78% with canine, cotton rat, equine, feline, mouse, porcine, and rat IL-1 beta. Human recombinant IL-1beta produced in E. coli is a non-glycosylated, IL-1 beta polypeptide chain containing 153 amino acids and having a molecular mass of 17.0 kDa.
  • Synonyms :

    IL1B; IL-1; IL1F2; IL1-BETA
  • NCBI Gene ID :

    3553
  • UniProt :

    P01584
  • Accession Number :

    NP_000567
  • Accession Number mRNA :

    NM_000576
  • Chromosomal Location :

    2q14
  • Reactivity :

    Human
  • Cross Reactivity :

    Human
  • Sequence :

    APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
  • Assay Protocol :

    The lyophilized rh IL-1ß is soluble in water and most aqueous buffers and can be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
  • Endotoxin :

    < 0.1 ng per µg (IEU/µg) of rh IL-1ß
  • Purity :

    > 98% by SDS-PAGE
  • Bioactivity :

    Measured in a cell proliferation assay using murine D10G4.1 cells. The ED50 for this effect is typically 2-10 pg/ml.
  • Length :

    153
  • Form :

    Lyophilized
  • Buffer :

    PBS
  • Reconstitution :

    Water
  • Molecular Weight :

    17.0 kDa
  • Storage Conditions :

    Lyophilized IL-1ß although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1ß should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Avoid repeated freeze-thaw cycles.
  • Host or Source :

    E. coli
  • N Terminal Sequence :

    APVRSL and MAPVRS

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide