GM-CSF Recombinant Protein
CAT:
209-M30-013
Size:
50 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

GM-CSF Recombinant Protein
- Description: GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. The human and murine molecules are species-specific and exhibit no cross-species reactivity. Recombinant murine GM-CSF is a 14.2 kDa globular protein consisting of 124 amino acids residues.
- Synonyms: Csf2; Csfgm; GMCSF; Gm-CSf; MGI-IGM
- CAS Number: 9000-83-3
- NCBI Gene ID: 12981
- UniProt: P01587
- Accession Number: NP_034099.2
- Accession Number mRNA: NM_009969.4
- Gene Location: 11 B1.3; 11 29.5 cM
- Host: E. coli
- Origin Species: Mouse
- Species Reactivity: Mouse
- Sequence: MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
- Detection Range: Testing in Progress.
- Endotoxin: < 0.1 ng per µg of GM-CSF
- Purity: > 98% by SDS-PAGE
- Length: 125
- Form: Lyophilized
- Buffer: 30 mM Tris pH8
- Reconstitution: The lyophilized mouse GM-CSF is soluble in water and most aqueous buffers. It can be reconstituted in water to a concentration of 100 µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. For most in vitro applications, mouse GM-CSF exerts its biological activity in the concentration range of 0.05 to 0.5ng/ml.
- Molecular Weight: 14.2 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: The lyophilized mouse GM-CSF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted mouse GM-CSF should be stored in working aliquots at -20°C.