FGF-21 Recombinant Protein
CAT:
209-500-003S
Size:
10 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
FGF-21 Recombinant Protein
- Description: Bovine FGF-21 is a secreted growth factor that is a member of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. Recombinant bovine FGF-21 is a 19.5 kDa protein containing 182 amino acid residues.
- Synonyms: Fibroblast Growth Factor-21, FGFL
- CAS Number: 9000-83-3
- NCBI Gene ID: 785579
- UniProt: E1BDA6
- Accession Number: XP_005219543.1
- Accession Number mRNA: XM_005219486.4
- Host: E. coli
- Origin Species: Bovine
- Species Reactivity: Bovine
- Sequence: AHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAHLEIRADGTVVGAARQSPESLLELKALKPGVIQILGVKTSRFLCQGPDGKLYGSLHFDPKACSFRELLLEDGYNVYQSETLGLPLRLPPQRSSNRDPAPRGPARFLPLPGLPAAPPDPPGILAPEPPDVGSSDPLSMVGPSYGRSPSYTS
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98% by SDS-PAGE & gel filtration
- Length: 182
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized bFGF-21 in 0.4% NaHCO3 or water, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar
- Molecular Weight: 19.5 kDa
- Shipping Conditions: Room Temperature