Endomucin Recombinant Protein

Endomucin Recombinant Protein

• Description: Endomucin (endothelial sialomucin; also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60% and 30% aa identity with rat and human Endomucin, respectively.
• Synonyms: Endomucin-2, Gastric cancer antigen Ga34, Mucin-14
• CAS Number: 9000-83-3
• NCBI Gene ID: 51705
• UniProt: Q9ULC0
• Accession Number: NP_001153166.1
• Accession Number mRNA: NM_001159694.1
• Gene Location: 4q24
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Human
• Tag: His-Tag
• Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS
• Detection Range: Data not available.
• Purity: > 95% by SDS-PAGE
• Length: 197
• Form: Lyophilized
• Buffer: 10mM NaP, pH 7.0
• Reconstitution: The lyophilized human soluble Endomucin is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100 µg/ml.
• Molecular Weight: 20.4 kDa
• Shipping Conditions: Room Temperature
• Storage Conditions: The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity.