CD34, soluble
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CD34, soluble
Description :
CD34 is a highly glycosylated type I membrane protein that is selectively expressed on hematopoietic stem cells and vascular endothelium. It has been widely used as a molecular marker for the identification, isolation, and manipulation of hemopoietic stem cells and progenitors. CD34 can function as a regulator of hemopoietic cell adhesion by mediating the attachment of stem cells to bone marrow stromal cells or other bone marrow components. The full length human CD34 is a 385 amino acid protein, consisting of a 31 amino acid signal sequence, a 74 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain and a 259 amino acid extracellular domain. Recombinant human sCD34 is a 258 amino acid polypeptide containing only the extracellular domain of the full length CD34 protein which is fused to a C terminal His-tag (6xHis) .Synonyms :
CD34NCBI Gene ID :
947UniProt :
P28906Accession Number :
NP_001764.1Accession Number mRNA :
NM_001773.2Chromosomal Location :
1q32Reactivity :
HumanCross Reactivity :
HumanLabel :
His-TagSequence :
SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLEHHHHHHPurity :
> 95% by SDS-PAGEBioactivity :
Data not available.Length :
267Form :
LyophilizedMolecular Weight :
28.6 kDaHost or Source :
E. coliN Terminal Sequence :
SLDNN

