4-1BBL Recombinant Protein

4-1BBL Recombinant Protein

• Description: 4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 205 amino acid extracellular domain. The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. Recombinant human 4-1BBL is a soluble 19.5 kDa protein consisting of 185 amino acid residues.
• Synonyms: TNFSF9; CD137L; 4-1BB-L
• CAS Number: 9000-83-3
• NCBI Gene ID: 8744
• UniProt: P41273
• Accession Number: NP_003802.1
• Accession Number mRNA: NM_003811.3
• Gene Location: 19p13.3
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Human
• Sequence: MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
• Detection Range: Determined by the dose-dependent stimulation of IL-8 production by human PBMC. The expected ED50 for this effect is 5-10 ng/ml. NOTE: Results may vary with different PBMC donors.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 97% by SDS-PAGE & HPLC analyses
• Length: 185
• Form: Lyophilized
• Molecular Weight: 19.5 kDa
• Shipping Conditions: Room Temperature