Aminopeptidase Recombinant Protein
CAT:
209-100-401S
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Aminopeptidase Recombinant Protein
- Description: Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at or adjacent to specific residues or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes including prenatal and postnatal development, reproduction, signal transduction, the immune response, various autoimmune and degenerative diseases, and cancer. They are also an important research tool, frequently used in the analysis and production of proteins. Recombinant Aeromonas Aminopeptidase is a 31.4 kDa protein containing 291 amino acid residues.
- Synonyms: Proteolytic Enzymes, Peptidases,Proteinases
- CAS Number: 9000-83-3
- UniProt: Q01693
- Host: E. coli
- Origin Species: Aeromonas
- Sequence: MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
- Detection Range: Sequentially cleaves N-terminal amino acids except E, D, and X-P.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 95% by SDS-PAGE & HPLC analyses
- Length: 291
- Form: Lyophilized
- Molecular Weight: 31.4kDa
- Shipping Conditions: Room Temperature