AITRL Recombinant Protein

AITRL Recombinant Protein

• Description: AITRL, a member of the TNF superfamily, is expressed in endothelial cells, and signals through the AITR receptor. AITRL regulates T-cell proliferation and survival, and effectuates the interaction between T lymphocytes and endothelial cells. The AITRL gene codes for a type II transmembrane protein comprised of 177 amino acids, including a 28 amino acid cytoplasmic region, a 21 amino acid transmembrane domain and a 128 amino acid extracellular domain. Recombinant human soluble AITRL is a 14.3 kDa protein, containing 126 amino acid residues corresponding to the extracellular domain of AITRL.
• Synonyms: TNFSF18; TL6; AITRL; GITRL; hGITRL
• CAS Number: 9000-83-3
• NCBI Gene ID: 8995
• UniProt: Q9UNG2
• Accession Number: NP_005083.2
• Accession Number mRNA: NM_005092.3
• Gene Location: 1q23
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Human
• Sequence: ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI
• Detection Range: Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 1.0-10.0 ng/ml. Please Note: Results may vary with PBMC donors.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 97% by SDS-PAGE & HPLC analyses
• Length: 126
• Form: Lyophilized
• Molecular Weight: 14.3 kDa
• Shipping Conditions: Room Temperature