Recombinant Human Coagulation factor IX (F9), partial

CAT:
399-CSB-EP007936HU1-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Coagulation factor IX (F9), partial - image 1

Recombinant Human Coagulation factor IX (F9), partial

  • Product Name Alternative:

    (Christmas factor) (Plasma thromboplastin component) (PTC)
  • Abbreviation:

    Recombinant Human F9 protein, partial
  • Gene Name:

    F9
  • UniProt:

    P00740
  • Expression Region:

    144-239aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    FCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFP
  • Tag:

    N-terminal 6xHis-GST-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Cardiovascular
  • Relevance:

    Factor IX is a vitamin K-dependent plasma protein that participates in the intrinsic pathway of blood coagulation by converting factor X to its active form in the presence of Ca (2+) ions, phospholipids, and factor VIIIa.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    42.0 kDa
  • References & Citations:

    "X-linked thrombophilia with a mutant factor IX (factor IX Padua) ." Simioni P., Tormene D., Tognin G., Gavasso S., Bulato C., Iacobelli N.P., Finn J.D., Spiezia L., Radu C., Arruda V.R. N. Engl. J. Med. 361:1671-1675 (2009)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial