Recombinant Human Coagulation factor IX (F9), partial

CAT:
399-CSB-MP007936HU2d9-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Coagulation factor IX (F9), partial - image 1

Recombinant Human Coagulation factor IX (F9), partial

  • Product Name Alternative:

    Christmas factor; Plasma thromboplastin component
  • Abbreviation:

    Recombinant Human F9 protein, partial
  • Gene Name:

    F9
  • UniProt:

    P00740
  • Expression Region:

    93-171aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    DGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCE
  • Tag:

    C-terminal hFc1-tagged
  • Type:

    Developed Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Cardiovascular
  • Relevance:

    Factor IX is a vitamin K-dependent plasma protein that participates in the intrinsic pathway of blood coagulation by converting factor X to its active form in the presence of Ca (2+) ions, phospholipids, and factor VIIIa
  • Endotoxin:

    Not test
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    38.3 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial